SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064073 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064073
Domain Number 1 Region: 784-955
Classification Level Classification E-value
Superfamily SPOC domain-like 3.57e-50
Family SPOC domain 0.00013
Further Details:      
 
Domain Number 2 Region: 372-526
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.05e-27
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 109-247
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000591
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064073   Gene: ENSRNOG00000047499   Transcript: ENSRNOT00000070994
Sequence length 955
Comment pep:novel chromosome:Rnor_5.0:2:229554811:229557675:-1 gene:ENSRNOG00000047499 transcript:ENSRNOT00000070994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSAGREPLPRRSPRWRRASPLCETSAGWRVSQLRRDDLRRPSTMKGKERSPVKPKRSRG
GEDSSSRGERSKKLGGSGGSNGSSSGKTDSGGSRRSLHLDKSSSRGGSREYDTGGGSSSS
RLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGVEYKTLKISELGSQL
SDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVLY
DRPLKIEAVYVSRRRSRSPLDKDTYAPSSSVVGSSVGSHRHAPGGGGGQRSLSPGGAALG
YRDYRLQQLALGRLPPPPPPPLPRELERERDYPFYDRVRPAYSLEPRVGAGAGAAPFREV
DEISPEDDQRANRTLFLGNLDITVTENDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLKF
ENLDMSHRAKIAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTI
RTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPL
PLTHYELVTDTFGHRAPDPLRSARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSARAA
TSAVTAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESDR
PRKQRHCTPSPDRSPELSSNRDRYNSDNDRSSRLLLLERPSPVRDRRGSLEKSQSDKRDR
KNSASAERDRKHRTAAPTEGKTPLKKEDRSDGNTPSASTSSSKQKPPSQKQDGGTAPVAA
SSPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQ
PKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSDTAASTQRPLRNLVSYLKQKQ
AAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVR
Download sequence
Identical sequences ENSRNOP00000064073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]