SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000064221 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000064221
Domain Number 1 Region: 192-285
Classification Level Classification E-value
Superfamily TAFH domain-like 1.83e-35
Family TAFH domain-like 0.00000302
Further Details:      
 
Domain Number 2 Region: 478-525
Classification Level Classification E-value
Superfamily Histone-fold 2.43e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000064221   Gene: ENSRNOG00000045974   Transcript: ENSRNOT00000073060
Sequence length 691
Comment pep:known_by_projection chromosome:Rnor_5.0:3:181753108:181816579:1 gene:ENSRNOG00000045974 transcript:ENSRNOT00000073060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPGTPAGLAKGAAAATPSLPRTPAATTGAIRATLTPTVLAPRLPQPPQNPTNIQNFQLPP
GMVLVRSENGQLLMIPQQALAQMQAHAQAQPQSTMAPRPATPTGAAPVQISTVQAPGTPI
IARQVTPTTIIKQVSQAQTTVQPTTTLQRSPGVQPQLVLGGSAQPASLGTATAVQTGTPQ
RTVTGASTTSTAATETMENVKKCKSFLSTLIKLASSGKQSTETAANVKDLVQNLLDGKIE
AEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPASQATTALT
AVVLSSSVQRTAGKTAASVTSALQPPVISLTQPTQVGVGKQAPPTPLVIQQPPKPGALIR
PPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAA
AQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLL
PAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRY
EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQ
ELAQMRQRDANLTALAAIGPRKKRKVDCAGPGSGAEGSGPGAAVPGGSGVGTPRQFTRQR
ITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSRNOP00000064221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]