SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000007 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000007
Domain Number 1 Region: 110-592
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.29e-132
Family Pyridoxal-dependent decarboxylase 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000007   Gene: ENSRNOG00000000007   Transcript: ENSRNOT00000000007
Sequence length 593
Comment pep:known chromosome:RGSC3.4:3:52789370:52811580:1 gene:ENSRNOG00000000007 transcript:ENSRNOT00000000007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKS
RLVSAFRERQASKNLLSCENSDPGARFRRTETDFSNLFAQDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSN
KDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Download sequence
Identical sequences C9E895 P18088
NP_058703.1.100692 NP_058703.1.4139 XP_017446943.1.100692 XP_017446944.1.100692 ENSRNOP00000000007 ENSRNOP00000000008 10116.ENSRNOP00000000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]