SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000047 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000047
Domain Number 1 Region: 538-565,609-689
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000135
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000047   Gene: ENSRNOG00000000041   Transcript: ENSRNOT00000000047
Sequence length 703
Comment pep:known chromosome:RGSC3.4:14:1581267:1586873:1 gene:ENSRNOG00000000041 transcript:ENSRNOT00000000047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASPEPPQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMPCAQALVQGLFPVIRWL
PQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPGNNDSTLNNTATLTVGLQDCGRDCH
AIRIATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGASVTILTSQAKHLLGVRI
PRHQGLGMVIHTWLSLLQNVGQANLCDVVTSAVCLAVLLTAKELSDRYRHYLKVPVPTEL
LVIVVATIASHFGQLHTRFGSSVAGNIPTGFVAPQIPDPKIMWSVALDAMSLALVGSAFS
ISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAALSKTLVKIATGCQTQLSS
VVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKDLPQLWRLSPADALVWVA
TAATCVLVSIEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDSTFYEDAAEFEGLLPPPE
VRVFRFTGPLYYANKDFFLRSLYSLTGLDAGYSATRKDRGTEVGVSNRSLVDRKDLGSVS
SGDGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRKNYRALDITLLLACCSPSVRDT
LRKGGFLGEDQGTEEELLFPSVHSAVETACARREELMAADSAL
Download sequence
Identical sequences Q5RKK1
NP_071623.2.100692 NP_071623.2.4139 ENSRNOP00000000047 ENSRNOP00000000047 10116.ENSRNOP00000000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]