SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000107 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000107
Domain Number 1 Region: 234-332
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-24
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 363-457
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-21
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 2-93
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-21
Family PDZ domain 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000000107
Domain Number - Region: 131-218
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00124
Family PDZ domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000107   Gene: ENSRNOG00000000096   Transcript: ENSRNOT00000000107
Sequence length 524
Comment pep:known chromosome:RGSC3.4:2:191659526:191675995:1 gene:ENSRNOG00000000096 transcript:ENSRNOT00000000107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTFNPRECKLSKKEGQNYGFFLRIEKDTDGHLVRVIEEGSPAEKAGLLDGDRVLRING
VFVDKEEHAQVVDLVRKSGNSVTLLVLDGDSYEKAVKHQVDLKELDQSPREPALNEKKPD
LGMNGGVETCAQPRLCYLVKEGNSFGFSLKTIQGELGLYYSEGVMKAGIPLNPGLGGDEE
MNDIRGDSHADLSVQSVVPKVTKSGSRIMFLLVDKETARCHSEQKTPFKRETASLKLLPH
QPRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGESVEAL
DHDGVVEMIRNGGDQTTLLVLDKEADRIYSLARFSPLLYCQSQELPNGSVKEAPAPISAP
LEAPGSATTEDVGDHKPKLCRLIKEDDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLEN
EDIIIEVNGENVQDEPYDRVVERIKSSGEHVTLLVCGKVAYSYFQAKKIPILSSLADPLV
AGPDAKGETEHDSAESTKDSSHPARDRTLSAASHSSSNSEDTVM
Download sequence
Identical sequences 10116.ENSRNOP00000061514 ENSRNOP00000000107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]