SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000180 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000180
Domain Number 1 Region: 176-267
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.57e-17
Family GABA-aminotransferase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000017
Family GABA-aminotransferase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000180   Gene: ENSRNOG00000000167   Transcript: ENSRNOT00000000180
Sequence length 311
Comment pep:known chromosome:RGSC3.4:X:39800526:39810464:1 gene:ENSRNOG00000000167 transcript:ENSRNOT00000000180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCEIYSDAGNHASMIQGIRNSGAVKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMD
GMYTCVQVHVYQYCYPMIKMMTIIHIMCVYITRNPFYEVDSIISKLIISRYYYYHYYYYS
YSYSYSYHCMRKLRHEHVESQSHTGSKHQRRGHYYILTHKGAKFHRAEFVFLPHSDNVKH
MRQLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLAKHSIYVQAINYPTVPRGEELL
RLAPSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFG
NMGPQYVTTYA
Download sequence
Identical sequences ENSRNOP00000000180 10116.ENSRNOP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]