SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000750 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000750
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily UBC-like 6.92e-66
Family UBC-related 0.000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000750   Gene: ENSRNOG00000000611   Transcript: ENSRNOT00000000750
Sequence length 147
Comment pep:known chromosome:RGSC3.4:20:18040687:18086179:1 gene:ENSRNOG00000000611 transcript:ENSRNOT00000000750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDY
PFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLV
PDIAQIYKSDKEKYNRHAREWTQKYAM
Download sequence
Identical sequences A0A024QZJ2 A0A096P578 A0A0B4J1B4 A0A0B8RS64 A0A0D9R4L1 A0A0N8EUJ5 A0A0Q3UQK7 A0A1S3AMA7 A0A1S3F8S8 A0A1U7QC69 A0A1U7U3L1 A0A1V4K6I4 A0A218UXC3 A0A2I2YMV6 A0A2K5E077 A0A2K5KL21 A0A2K5QU72 A0A2K5VRH8 A0A2K5Z6Z7 A0A2K6DCF5 A0A2K6FAC2 A0A2K6KWV1 A0A2K6QRW1 A0A2K6UM77 D3ZDK2 E1BZJ2 F6QMS1 G1LUP8 G1RNY3 G7N2F6 H0XQ58 H2NAV1 H2Q1X5 H9G8V3 I3M959 J9NTA2 M3YG71 P51668 P61080 Q06AA8 Q2TA10 Q3UFQ4 U6CVF7
ENSMPUP00000010328 ENSCJAP00000019568 ENSGALP00000033525 ENSPPYP00000002821 ENSPCAP00000006515 gi|4507773|ref|NP_003329.1| ENSAMEP00000010797 000141577|e3oj4A1|216.1.1.7|A:7-153 000407317|e3oj4D1|216.1.1.7|D:7-153 000423380|e2yhoH1|216.1.1.7|H:3-149 d2yhob1 d2yhod1 d2yhof1 d2yhoh_ d3ptfa1 d3ptfb1 d4qplb1 d4qpld1 ENSBTAP00000051358 NP_001033256.1.59421 NP_001033256.1.76553 NP_001072142.1.46622 NP_001102000.1.100692 NP_001102000.1.4139 NP_001186455.1.86415 NP_001229378.1.31192 NP_001244792.1.72884 NP_003329.1.87134 NP_003329.1.92137 NP_663395.1.92730 XP_001163868.1.37143 XP_002188503.1.42559 XP_002718528.1.1745 XP_002756393.1.60252 XP_002820966.1.23681 XP_003226486.2.98722 XP_003258301.1.23891 XP_003783693.1.62490 XP_003821220.1.60992 XP_003928756.1.74449 XP_004283416.1.21590 XP_004369932.1.4749 XP_004396160.1.74151 XP_004427170.1.5094 XP_004473256.1.11602 XP_004583449.1.84141 XP_004657912.1.11716 XP_004680936.1.23501 XP_004780705.1.14098 XP_004858362.1.39548 XP_005070838.1.91757 XP_005153765.1.78019 XP_005301781.1.60341 XP_005334386.1.77405 XP_005360221.1.66349 XP_005488123.1.73095 XP_005534192.1.90289 XP_005565871.1.63531 XP_005895910.1.15283 XP_005962565.1.78601 XP_006051297.1.26621 XP_006831164.1.41390 XP_006895640.1.29581 XP_006915675.1.64745 XP_006979115.1.50099 XP_007060726.1.26238 XP_007106869.1.24612 XP_007424937.1.37977 XP_007464536.1.90284 XP_007478396.1.35504 XP_007537581.1.11023 XP_007957043.1.48129 XP_007961592.1.81039 XP_008059872.1.4292 XP_008143708.1.99482 XP_008516996.1.77740 XP_008578367.1.73410 XP_008935322.1.37566 XP_009085817.1.15306 XP_009896957.1.92783 XP_010365812.1.97406 XP_010406963.1.2935 XP_010712437.1.16129 XP_010837945.1.44457 XP_011360439.1.92234 XP_011586058.1.59079 XP_011713537.1.29376 XP_011845736.1.47321 XP_011906165.1.92194 XP_012021731.1.54773 XP_012301183.1.9421 XP_012513146.1.63892 XP_012618286.1.48125 XP_012872670.1.60039 XP_014748694.1.99236 XP_014925677.1.86478 XP_015507786.1.82291 XP_015674324.1.16292 XP_015721677.1.68032 XP_015983139.1.101085 XP_017397743.1.71028 XP_017681458.1.3805 XP_017745403.1.44346 XP_017897092.1.57651 XP_018890869.1.27298 XP_019291636.1.44245 XP_019394127.1.79039 XP_019493983.1.44202 XP_019587468.1.88060 XP_019790809.1.83887 XP_019808342.1.53367 XP_020042546.1.5219 XP_020638833.1.8467 XP_020759380.1.74333 XP_021060753.1.100879 XP_021256371.1.32913 XP_021391283.1.53032 XP_021555254.1.83697 XP_850730.1.84170 ENSMUSP00000020085 ENSGALP00000033525 ENSSTOP00000006373 ENSP00000363019 ENSP00000363019 ENSNLEP00000014947 ENSCJAP00000019568 ENSECAP00000007319 ENSCAFP00000036387 ENSMUSP00000020085 ENSPVAP00000006976 ENSPANP00000020503 ENSDNOP00000026289 ENSPPYP00000002821 ENSOGAP00000018249 ENSPVAP00000006976 ENSTTRP00000008767 ENSNLEP00000014947 ENSDORP00000013172 ENSDORP00000013172 ENSSTOP00000006373 10090.ENSMUSP00000020085 10116.ENSRNOP00000000750 13616.ENSMODP00000038557 28377.ENSACAP00000004229 9031.ENSGALP00000033525 9598.ENSPTRP00000004338 9600.ENSPPYP00000002821 9606.ENSP00000363019 9615.ENSCAFP00000018123 9796.ENSECAP00000007319 9913.ENSBTAP00000051358 ENSPTRP00000004338 ENSETEP00000001849 ENSCHOP00000001072 ENSOGAP00000018249 ENSETEP00000001849 ENSMUSP00000020085 ENSACAP00000004229 ENSPTRP00000004338 ENSTTRP00000008767 ENSACAP00000004229 ENSCAFP00000036387 ENSP00000363019 ENSPCAP00000006515 ENSCHOP00000001072 ENSBTAP00000051358 ENSMPUP00000010328 ENSRNOP00000000750 ENSAMEP00000010797 ENSECAP00000007319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]