SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001263 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001263
Domain Number 1 Region: 438-548
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-24
Family PDZ domain 0.0051
Further Details:      
 
Domain Number 2 Region: 223-316
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-22
Family PDZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 327-425
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.014
Further Details:      
 
Domain Number 4 Region: 35-96
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000906
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001263   Gene: ENSRNOG00000000955   Transcript: ENSRNOT00000001263
Sequence length 588
Comment pep:known chromosome:RGSC3.4:12:8359540:8420393:-1 gene:ENSRNOG00000000955 transcript:ENSRNOT00000001263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTSDEMVPVQQASSASSLDPLCFECGQQHWARENHLYNYQGEVDDDLVCHICLQPLLQ
PLDTPCGHTFCHKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSV
CQDVMQRCDLEAHLKNRCLGASHRRVDLERRKTSQAHTQIEGETGSTVIDPPGPSPPETD
CLGTVPGERNSTPAPLPVWTEDPGLDNPAFEESAAADSVQQPLSLPEGEITTIEIHRTNP
YIQLGISIVGGNETPLINIVIQEVYRDGAIARDGRLLAGDQILQVNNCDISNVSHNYARA
VLSQPCSTLHLTVLRERRFGSRANNHADGSAPRDEVFQVLLHKRDSAEQLGIKLVRRTDE
PGVFILDLLEGGLAAQDGRLSSNDRVLAINGHDLKQGTPELAAHIIQASGERVNLTIARP
GKPQPSNGSREAGAHSSNHAQPPSHSRPSSHKDLTRCVTCQEKHITVKKEPHESLGMTVA
GGRGSKSGELPIFVTSVPPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKASAA
SPAVILKALEVQIAEEAAQATEEQPGAFSENEYDASWSPSWVMWLGLP
Download sequence
Identical sequences ENSRNOP00000001263 10116.ENSRNOP00000001263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]