SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001636 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001636
Domain Number 1 Region: 4-163
Classification Level Classification E-value
Superfamily UBC-like 1.26e-55
Family UBC-related 0.00000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001636   Gene: ENSRNOG00000001222   Transcript: ENSRNOT00000001636
Sequence length 241
Comment pep:known chromosome:RGSC3.4:20:11368627:11389283:-1 gene:ENSRNOG00000001222 transcript:ENSRNOT00000001636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGEATAVCTLSSPTTWRH
CHANTNTGSCRASAPIVSSFPPQTGSSDHDWDNDSYCTAKDSSCCPQGGSRLSSLPLPAM
G
Download sequence
Identical sequences 10116.ENSRNOP00000001636 ENSRNOP00000001636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]