SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001639 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001639
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 1.63e-84
Family Integrin A (or I) domain 0.000000352
Further Details:      
 
Domain Number 2 Region: 333-452
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-21
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 621-697
Classification Level Classification E-value
Superfamily Integrin beta tail domain 5.23e-18
Family Integrin beta tail domain 0.0025
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000314
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Integrin beta EGF-like domains 0.002
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Integrin beta EGF-like domains 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000001639
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 500-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0173
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001639   Gene: ENSRNOG00000001224   Transcript: ENSRNOT00000001639
Sequence length 768
Comment pep:known chromosome:RGSC3.4:20:11446531:11485009:-1 gene:ENSRNOG00000001224 transcript:ENSRNOT00000001639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPHTLLLILAGLLFLGSALSEECTKYKVSNCRDCIQSGPGCSWCQKLNFTGPGEPDSL
RCDTRAQLLLKGCPADDIMDPKSFADLHPQYQVQRSQLSPQKVTLNLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAI
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKKAY
YKLSSRVFLDHTTIPDTLKVTYDSFCNNRVSSIGKSRGDCDGVQINNPVTFQVKVTASEC
IQEQSFVIRALGFTDTVTVQVHPQCECQCRDQSRMRNLCGGKGVMECGICRCESGYIGKN
CECQTQGRSSQELEGNCRKDNSSIVCSGLGDCICGQCVCHTSDIPNKVIFGQYCECDNFN
CERYDGQVCGGLKRGSCSCGQCNCKEGFEGSACQCQRSTTGCLNARLVECSGRGRCQCNR
CICEKGYQPPLCEECPGCPLPCSTYVFCAECLKFDKGPFQKNCSVQCANVTLQTVPFKKK
PCKERDSEGCWITYTLQQKDGNAYNIHVDDDRECVKGPNVAAIIGGTVAGVVLIGVLLLV
IWKALTHLTDLNEYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences B2RYB8
10116.ENSRNOP00000001639 NP_001032869.2.100692 NP_001032869.2.4139 ENSRNOP00000001639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]