SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001812 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001812
Domain Number 1 Region: 135-207
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000025
Family HtrA-like serine proteases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001812   Gene: ENSRNOG00000001339   Transcript: ENSRNOT00000001812
Sequence length 283
Comment pep:known chromosome:RGSC3.4:12:34472250:34500730:1 gene:ENSRNOG00000001339 transcript:ENSRNOT00000001812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEVRHRAESSEARAAAVSDIQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRADVDLYQVRTARHNIICLQNDHKALMKQVEEALHQLHARDKEKQARDMAEAREEAM
NRRLASDSPALPKAFARVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLQNVGSVVQ
HSEGKPLNVMVIRRGEKHQLRLTPTRWAGKGLLGLQYYPSPKMTASWELQESFFSWARAW
PGGFPHSLGSLKCKDLEESGGRLSVEVEETLWLPDVVSGLRHY
Download sequence
Identical sequences 10116.ENSRNOP00000001812 ENSRNOP00000001812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]