SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001912 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001912
Domain Number 1 Region: 463-530
Classification Level Classification E-value
Superfamily GYF domain 7.06e-22
Family GYF domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001912   Gene: ENSRNOG00000001410   Transcript: ENSRNOT00000001912
Sequence length 1042
Comment pep:known chromosome:RGSC3.4:12:19586308:19595243:1 gene:ENSRNOG00000001410 transcript:ENSRNOT00000001912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAETLNFGPEWLRALSSGGSVASPPPSPAMPKYKLADYRYGREEMLALYVKENKVPEEL
QDKEFAAVLQEEPLQPLALEPLTEDEQRNFSLSVNSVAVLRLMGKGAGPPLAATSRGRGS
TRSRGRGRGDSCFYQRSIEEGDGAFGRNPREIQRSQSWDDRGERRFEKSARRDGVRSGFE
EGGAGPRKEHARSDSENWRSLREEQEDDSSWRLGAGPRRDGDRWRSTSPDGGPRSAGWRE
HGERRRKFDFDLRGERGGCGEEDGRVGGGNSHLRRCRGLDGFEDDKDGLPEWCLDDEDEE
MGTFDASGAFLPLKKGPKEPIPEEQELDFQGLEEEEEEPSDGVDEEGPEAGGKEVTPLPP
SEKSSSPSSLPALGPLWTANEDGEAVEKELPPAEGDEMRGLPLSPRISSPPAGPPADLED
EEGLKHLQQEAEKLVASLQDSSLEEEQFTAAMQTQGLRHSTAATALPLSHGAARKWFYKD
PQGEIQGPFTTQEMAEWFQAGYFSMSLLVKRGCDEGFQPLGEVIKMWGRVPFAPGPSPPP
LLGNMDQERLKKQQELAAAALYQQLQHQHFLQLVGSRQLPQCATLREKAAMGDLTPPQQQ
LTTFLQQLQALKTPRGGDQNLLPTMSRSLSVPDSGPLWDLHTSASSQSGGEASLWDIPIN
SSTQGPILEQLQLQHKFQERREVELRVKREEEERKRREEKRRQQQQQEEQKRRQEEEELF
RRKQVRQQELLLKLLQQQQATNVPVPPAPSSPPPLWAGLAKQGLSMKTLLELQMESERQL
HKQPAPREPLRAQAPNHRVQLGGLGTAPLNQWVSEAGPLWGGPDKSGGSSSGNLGLWEDT
LKSGGSLARSLGLKNSRSSPSLSDSYSHLSGRPVRKKTEEEEKLLKLLQGIPRPQDGFTQ
WCEQMLHTLSTTSSLDVPMAVAILKEVESPYDVHDYIRSCLGDTLEAKEFAKQFLERRAK
QKASQQRQQQQQQQQQQQQQQQEAWLSSSSLQTAFQANHSTKLGPGEGSKAKRRALMLHS
DPSILGYSLHGPSGEIESVDDY
Download sequence
Identical sequences D3ZQJ3
NP_001100603.1.100692 NP_001100603.1.4139 XP_017453816.1.100692 ENSRNOP00000001912 ENSRNOP00000001912 10116.ENSRNOP00000001912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]