SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001996 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001996
Domain Number 1 Region: 329-617
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-74
Family Protein kinases, catalytic subunit 0.000085
Further Details:      
 
Domain Number 2 Region: 51-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000714
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 109-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000285
Family LIM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 158-258
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000434
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 21-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000368
Family LIM domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001996   Gene: ENSRNOG00000001470   Transcript: ENSRNOT00000001996
Sequence length 647
Comment pep:known chromosome:RGSC3.4:12:23091784:23125718:1 gene:ENSRNOG00000001470 transcript:ENSRNOT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTLLCCTWREERMGEEGSELPVCASCSQSIYDGQYLQALNADWHADCFRCCECSTSLS
HQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGD
GDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHIGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLASPVHTPSGQAGSSARQKPVLRSCSID
TSPGAGSLVSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFG
LARLMIDEKGQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
Download sequence
Identical sequences G3V663
ENSRNOP00000001996 10116.ENSRNOP00000001996 ENSRNOP00000001996 NP_113915.2.100692 NP_113915.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]