SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002323 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002323
Domain Number 1 Region: 358-481
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-36
Family DEP domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 180-290
Classification Level Classification E-value
Superfamily PDZ domain-like 3.06e-23
Family PDZ domain 0.0000331
Further Details:      
 
Domain Number 3 Region: 2-32
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000227
Family DIX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002323   Gene: ENSRNOG00000001708   Transcript: ENSRNOT00000002323
Sequence length 668
Comment pep:known chromosome:RGSC3.4:11:82597654:82621890:-1 gene:ENSRNOG00000001708 transcript:ENSRNOT00000002323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGG
IGDSRPPSFHPHASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTTKGERRR
EPGGYDSSSTLMSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSR
IERSSSFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA
ADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLP
RSEPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSI
HSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYA
SNLLKAGFIRHTVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPG
AAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYAGGSASSQHSEGSRSSGSNRSGSDRRKE
KDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHH
THPSYGPPGVPPLYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNP
SEFFVDVM
Download sequence
Identical sequences ENSRNOP00000002323 ENSRNOP00000002323 10116.ENSRNOP00000002323 NP_001100551.1.100692 NP_001100551.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]