SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003088 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003088
Domain Number 1 Region: 613-724
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-25
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 2 Region: 486-591
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-22
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 271-365
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-20
Family PDZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 374-472
Classification Level Classification E-value
Superfamily PDZ domain-like 1.17e-18
Family PDZ domain 0.017
Further Details:      
 
Domain Number 5 Region: 37-106
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000185
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003088   Gene: ENSRNOG00000002272   Transcript: ENSRNOT00000003088
Sequence length 728
Comment pep:known chromosome:RGSC3.4:14:35888702:35992436:1 gene:ENSRNOG00000002272 transcript:ENSRNOT00000003088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPDLADDPDPSPEPLCVVCGQNHSPEENHFYTYTEDVDDDLVCHICLQALLDPLDTPC
GHTYCTLCLTNFLVEKDFCPVDRKPVVLQHCKKSNILVNKLLNKLLVNCPFTEHCSEVLQ
RCNLQYHFQTSCKGASHYGLTKDRKRRSQDGCPDGCASLTATTLSPEVSAAATISLMTDE
PGLDNPAYTSSVEDGEPVTNPSDTGRSNRTRARPFERSTMRSRSFKKINRALSALRRTKS
GSAVANHADQGRDNSENDTVPEVFPRLFHLIPDGEITSIKINRVDPNESLSIRLVGGSET
PLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVPHNYAVRLLRQPCQVLRLTVL
REQKFRSRSNAPAPDSYGPRDDSFHVILNKSSPEEQLGIKLVRRVDEPGVFIFNVLNGGV
ADRHGQLEENDRVLAINGHDLRFGSPESAAHLIQASERRVHLVVSRQVRQPSPDIFQEAG
CISNGQQSPVSGERSTSSKPAATCHEKVVSVQKDPNESLGMTVGGGASHREWDLPIYVIS
VEPGGVISRDGRIKTGDILLNVNGIELTEVSRTEAVAILKSTPSSVVLKALEVKEQETQE
DCSPAALDSNHNVTPPGDWSPSWVMWLELPQYLYNCKDVILRRNTAGSLGFCIVGGYEEY
SGNQPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMMHACLARMLKELKGKITLTI
ASWPGTFL
Download sequence
Identical sequences B6RHI6
NP_001101828.1.100692 NP_001101828.1.4139 XP_017454776.1.100692 ENSRNOP00000003088 ENSRNOP00000003088 10116.ENSRNOP00000003088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]