SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003239 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003239
Domain Number 1 Region: 42-174
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.98e-48
Family Regulator of G-protein signaling, RGS 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003239   Gene: ENSRNOG00000002369   Transcript: ENSRNOT00000003239
Sequence length 180
Comment pep:known chromosome:RGSC3.4:13:68735814:68766955:1 gene:ENSRNOG00000002369 transcript:ENSRNOT00000003239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVTKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Download sequence
Identical sequences P49804
NP_062217.1.100692 NP_062217.1.4139 XP_006250078.1.100692 XP_021053741.1.100879 XP_021053742.1.100879 XP_021053743.1.100879 XP_021488560.1.76796 XP_021488561.1.76796 XP_021488562.1.76796 XP_021488563.1.76796 XP_021488564.1.76796 ENSRNOP00000003239 ENSRNOP00000003239 10116.ENSRNOP00000003239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]