SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003284 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003284
Domain Number 1 Region: 40-397,426-483
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.09e-48
Family Pyridoxal-dependent decarboxylase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003284   Gene: ENSRNOG00000002407   Transcript: ENSRNOT00000003284
Sequence length 785
Comment pep:known chromosome:RGSC3.4:10:1543542:1637788:-1 gene:ENSRNOG00000002407 transcript:ENSRNOT00000003284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASLEKIADPTLAEMGKNLKEAMRMLENSPRRIEEESGKKPVPEDIPGPLQGSGQDMVS
ILQLVQNLMHGDEDEEPQSTRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSD
TTLWLCRIFRYENGCAYFHEKEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPIIYLSA
AARPGLGPYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDVERGRLPLLLVA
NAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAATKCDSMTLTPG
LWLGLPAVPAVTLYKHDDPALTLIAGLTSNKPADKLRALPLWLSLQYLGLDGIVGRIKHA
CQLSQRLQESLKKVDHIKILVEDELSSPVVVFRFFQELPTLDPAFKVAAVSNIAAAAVGR
ERHSCDALNRWLGEQLKQLVPQCGLTVMDLDIDGTCVRFSPLMTAEALGTRGEDVDQLIT
CIQSKLPVLTCTLQLREEFKKEVEGTAGLLYVDDPNWPGIGVVRYEHANDDNTSLQSDPE
GEKIHTGLLKKLNELESDLTFKMGPEYKSMKSCIYIGMASDDVDVSELVETIAITAREIE
ENSRLLENMTEVVRKGIQEAQVQLQKANEERLLEEGVLRQIPVVGSVLNWFSPVQASQKG
RSFNLTAGSLESTEYTYVYKVQGTGVTPPPTPSGTRSKQRLPGQKPFKRSLRSSDAVSET
SSVSHIEDLEKVEQLPSGLEHDNLEAQCPEQPCRAADPVARQTEALQDEEDDHSQMGTRV
RRLKV
Download sequence
Identical sequences G3V6B0
NP_001128433.1.100692 NP_001128433.1.4139 ENSRNOP00000003284 10116.ENSRNOP00000003284 ENSRNOP00000003284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]