SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003568 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003568
Domain Number 1 Region: 621-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000081
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Third domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 6.15e-36
Family Second domain of FERM 0.0000901
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-23
Family First domain of FERM 0.00094
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-20
Family PDZ domain 0.00000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003568   Gene: ENSRNOG00000002625   Transcript: ENSRNOT00000003568
Sequence length 926
Comment pep:known chromosome:RGSC3.4:13:32438211:32610876:-1 gene:ENSRNOG00000002625 transcript:ENSRNOT00000003568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLSCPCNTAALLASFAVQSELGDYNQSENLAGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEILIGVMSGG
ILIYKNRVRMNTFLWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKTLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSSFTQEGTRVRPSSVGHLV
DHVVHTSPSEDFVSQRSPSSTQANSIVLESSPSQETPEDGQPPALPPKQSKKNSWNQIHF
SHSQQDLVNHTNESFDVPSSPEKSTPNGGIPHDNLVLIKMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELVLL
VRPNAVYDVVEEKLESEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLAQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVLLKGNEDYINANYINMEISSSSII
NQYIACQGPLPHTCKDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPSGSSSYGCYQ
VTCHSEEGNPAYIFRKMTLFNQEKNESRQLTQIQYTAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences G3V6B9
NP_001093949.1.100692 NP_001093949.1.4139 ENSRNOP00000003568 10116.ENSRNOP00000003568 ENSRNOP00000003568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]