SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003620 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003620
Domain Number 1 Region: 40-497
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.46e-89
Family GABA-aminotransferase-like 0.0000000000000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003620   Gene: ENSRNOG00000002636   Transcript: ENSRNOT00000003620
Sequence length 500
Comment pep:known chromosome:RGSC3.4:10:7040725:7137154:-1 gene:ENSRNOG00000002636 transcript:ENSRNOT00000003620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLLTTRRLVCSSQKNLHLFTPGSRYISQAAAKVDFEFDYDGPLMKTEVPGPRSQELMK
QLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQ
NASTFINRPALGILPPENFVDKLRESLMSVAPKGMCQLITMACGSCSNENAFKTIFMWYR
SKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMSFSKKMM
TGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVAHAGKTLLTGLL
DLQAQYPQFVSRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSGILADFK
Download sequence
Identical sequences P50554
ENSRNOP00000003620 XP_006245822.1.100692 10116.ENSRNOP00000003633 ENSRNOP00000003633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]