SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003741 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003741
Domain Number 1 Region: 658-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.68e-59
Family Nucleotide and nucleoside kinases 0.000000147
Further Details:      
 
Domain Number 2 Region: 392-491
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 494-608,651-685
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 4 Region: 238-334
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 132-238
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-27
Family PDZ domain 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003741   Gene: ENSRNOG00000002767   Transcript: ENSRNOT00000003741
Sequence length 849
Comment pep:known chromosome:RGSC3.4:X:88777585:88828504:1 gene:ENSRNOG00000002767 transcript:ENSRNOT00000003741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLP
SQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKNTPKLNGSGPSWWPECTCTNRDWYEQA
SPAPLLVNPEALEPSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFI
TKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPPE
TIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVN
NTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNS
SLGYLGAVESKVTYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVG
GEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIV
AQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPS
QGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHA
RTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYAR
PVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQD
NKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSI
EALMEMNRRQTYEQANKIFDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHY
IWVPSPEKL
Download sequence
Identical sequences Q62936
ENSRNOP00000003741 10116.ENSRNOP00000003741 NP_113827.1.100692 NP_113827.1.4139 ENSRNOP00000003741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]