SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003774 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003774
Domain Number 1 Region: 51-176
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-64
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003774   Gene: ENSRNOG00000002773   Transcript: ENSRNOT00000003774
Sequence length 205
Comment pep:known chromosome:RGSC3.4:13:85533882:85540173:-1 gene:ENSRNOG00000002773 transcript:ENSRNOT00000003774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWA
ESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNP
SSCGAEKQKGAKSSADCTSLVPQCA
Download sequence
Identical sequences P49799
1agr_E 1agr_H NP_058910.1.100692 NP_058910.1.4139 ENSRNOP00000003774 1agrE ENSRNOP00000003774 10116.ENSRNOP00000003774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]