SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003871 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003871
Domain Number 1 Region: 112-172,293-376
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 372-510
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5e-28
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003871   Gene: ENSRNOG00000002899   Transcript: ENSRNOT00000003871
Sequence length 662
Comment pep:known chromosome:RGSC3.4:10:48031107:48087922:-1 gene:ENSRNOG00000002899 transcript:ENSRNOT00000003871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGPSPRHSPRALRPDPGPAMSFFRRKVKGKEQEKNLDVKSIKASIAVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLRDSVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQS
SLAEPVSPSKKQETTASFVTESLDRRLGDSSSAPLLLTQSEGTDLSSRTQNTQNHLLLSQ
ECHSTHSLHHEVARTGTHQISTDSQESSSRLAVASRNSCSSPLRELSEKLMKSIEQDAVN
TFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQAVVFSAMEQEHFSEFL
RSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA
AKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLPEESHSGG
SDGSTAQSSVKKASIKILKNFDEAIVVDAASLDPESLYQRTYAGKMSFGRVSDLGQFIRE
SEPEPDVKKSKGFMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAHHDQPLEKST
KL
Download sequence
Identical sequences F1LNB3
ENSRNOP00000003871 NP_001108078.1.100692 NP_001108078.1.4139 ENSRNOP00000003871 10116.ENSRNOP00000003871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]