SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003872 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003872
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily PDZ domain-like 2.26e-25
Family PDZ domain 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003872   Gene: ENSRNOG00000002838   Transcript: ENSRNOT00000003872
Sequence length 140
Comment pep:known chromosome:RGSC3.4:X:88621186:88624218:-1 gene:ENSRNOG00000002838 transcript:ENSRNOT00000003872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNRIPYDDYPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREI
SMRVRFFPYNYHRQKERTVH
Download sequence
Identical sequences D3Z8K0 F6PUP7 Q9CZG9
10090.ENSMUSP00000015812 10116.ENSRNOP00000003872 9796.ENSECAP00000008625 ENSECAP00000008625 ENSMUSP00000015812 ENSECAP00000008625 NP_001100415.1.100692 NP_001100415.1.4139 NP_082579.1.92730 XP_001490236.2.31192 XP_003365852.1.31192 XP_005614299.1.31192 XP_005614300.1.31192 XP_006257130.1.100692 XP_006528365.1.92730 XP_008510283.1.77740 XP_011245987.1.92730 XP_014691080.1.49734 XP_014691081.1.49734 XP_014691082.1.49734 XP_014691083.1.49734 ENSRNOP00000003872 ENSMUSP00000015812 ENSMUSP00000051068 ENSRNOP00000003872 ENSMUSP00000015812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]