SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000003971 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000003971
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000407
Family PDZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000003971   Gene: ENSRNOG00000002959   Transcript: ENSRNOT00000003971
Sequence length 1436
Comment pep:known chromosome:RGSC3.4:X:29139761:29334302:1 gene:ENSRNOG00000002959 transcript:ENSRNOT00000003971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEDGGKAALSQKMRTGDELVNINGTPLYGSRQEALILIKGSFRILKLIVRRRNTPVSRPH
SWHVAKLLEGCPDVATTMHFPSEAFSLSWHSGCNTSDVSVQWCPLSRHCSTEKSSSIGSM
ESLEQPGQATYEGHLLPIEQNMYPSQRDSAYSSFSASSNASDCALSLKPEEPPSTDCVMS
GPGPTKVTDDQANVSETSGSSHSTSGGHMTSTSHASSCSEEGHHSGPAKMVRGPPEPPVR
RDSLQASRAQLLNGEQHRASEPVDSLQQKEKPALETMLPPRSSNQFCCISGQDQVTGEDH
QNCELSKPSESSQDDCDHLLIEGSSKALDSPKAHDKGSNKEFGLLKEASADLANTLSFGA
IPHLRGSIEHRHSAPEQLLASHLQQMHLDSRGNKGMELPTGQDGHQWTMSPLHNNPKGKK
SPGLPTGGTQDQTSKERKIKPTDDKLMVSANQSQSDALLGEVDGHPNRASRASSDLTGQQ
PSATCSPVQQTRDFFSANKVVGHTEATEEGDNEPKEGGRLGGRRSGGPRGRSIQNRRKSE
RFATNLRNEIQRRKAQLQKSKGPLSQLCDTKEDVEETQEPPESPPLPASNSSLLPSYKNV
PSHGDQLFNKSMILRARSSECLSQASESSKARVGLEGRMSPGQRSGQSSLALNTWWKASD
SSTLDTEKANAHHGVCRGHWRWSPEHNAQPQVALSTEGPSNPDDNKELKIPTPQAGDEAI
LMPFADRRKFFEESSKSLSTSHLPGLTTHNKPFIQRPKPIDQNFQSVSYRELRCHPMDQS
YHSADQPYHAADQSYHSLSPLQSEAPTYPDCFAPKGVDNSLYCKPVHHGDCDYHRTCSHP
CSAQGTVMHDPCICCSGEICPALLKRNLLPKCHNCRCHHHQCIRCTGCCHSPQHGAHEDS
SMASGNAWKSRKAAIQEFPVDKWKPITGNRKTSHSGREMAHSKANLSLSAPFRPHIENSA
LDLSNYRAVSSLDLLGDFKHASNTPEESSVYEDESSVASMPRPLRSRAFSESHISLEPQN
TRAWGKQQRESFSKGSETQPDTLGARKKAFPPPRPPPPNWEKYRLFRAAQQQQQQQQQQQ
QQQQQQQQEEEEEKEQEEKGEKEEDLPPQYFSSETTGSCAPITEEQPQSLKMGHQEASRQ
SSQSLQEQEAYAVHPSNFVPAVRSYPVTQPEKAQPPCYYGAHGLWRTTEQEATVTPKQEF
QHFSPPTGASGIPTSYSAYYNISVAKAELLNKLKQQPEMAEAGLGEEGVDYELAQKKIQL
IESISRKLSVLREAQRGLLDDINANAALGEEVEVNLKAVCKSNELEKYHLFIGDLDKVVN
LLLSLSGRLARVENALNSIDAESNQEKLVLREKKQQLTNQLADAKELKEHVDRREKLVFS
MVSRYLPQDQLQDYQHFVKMKSALIIEQRELEEKIKLGEEQLKCLKESLHLGPSNF
Download sequence
Identical sequences 10116.ENSRNOP00000003971 ENSRNOP00000003971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]