SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004032 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004032
Domain Number 1 Region: 656-928
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.25e-94
Family Inositol polyphosphate kinase (IPK) 0.00000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004032   Gene: ENSRNOG00000002969   Transcript: ENSRNOT00000004032
Sequence length 934
Comment pep:known chromosome:RGSC3.4:13:96044260:96138455:1 gene:ENSRNOG00000002969 transcript:ENSRNOT00000004032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVYCYALNSLVIMNSTNELKSGSPLPSGSETPQPSGRAALSPGSVFSPGRGASFLFPPA
ESLSLEEPGSAGGWRSGRRRLNSSSGSGGGSSSSNSSSSSGVGSPSWAGRLRGDAQQVVA
TRILSPPGPEEAQRKLRILQRELQNVQVNQKVGMFEAQIQAQTSAIQAPRSPRLGRARSP
SPCPFRSSSQPPERVLAPCSPSEERRTKSWGEQCTETPDANSRRRSRLSTHPSKDKEGVA
PLLGPASPTRLGTQSPSTSVRMERGSPASPRCGSPTPMEIDKRTAPSLEHFGTSLTLATK
VAASAASAGPHPGHDSVLMEADCELGAMRPWEAHLERRGQFLGRETGSAPEPIRTHIREP
PGRVERVHSVGGQGSWTPEVIKRPEEGTVDAQSSELSENPRWSRLPGDPGSVGPEKGGSR
IPGIRGPQQTLDSMREGSSALGLLGGSQAAQPGSMDVETGISCGRMLEPLPPGEVTTNLK
EPQCLPGDRMGMQPESSIVWPSAVEEAPLIWTCDTGIQLKGTWRSQDGDAHPSCQEKSPD
QKDKACSPSNIPAIPAVIITDMGAQEDGGLEEIQGSPRGPLPLRKLSSSSASSTGFSSSY
EDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVQWSPFVMSFKKKYPWIQ
LAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDL
LADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVT
KPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILI
AYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQH
DVPWQEGNREDGYLSGLNNLIDILTEMSQGSPLT
Download sequence
Identical sequences P42335
10116.ENSRNOP00000004032 NP_062185.2.100692 NP_062185.2.4139 XP_017454406.1.100692 XP_017454407.1.100692 ENSRNOP00000004032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]