SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004223 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004223
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Aquaporin-like 1.2e-70
Family Aquaporin-like 0.00000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004223   Gene: ENSRNOG00000003132   Transcript: ENSRNOT00000004223
Sequence length 263
Comment pep:known chromosome:RGSC3.4:7:1509023:1516128:1 gene:ENSRNOG00000003132 transcript:ENSRNOT00000004223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVALAFGLALATLVQTVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTG
AGMNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGA
RPSDSNGQPEGTGEPVELKTQAL
Download sequence
Identical sequences G3V6E0
10116.ENSRNOP00000004223 NP_001099189.1.100692 NP_001099189.1.4139 ENSRNOP00000004223 ENSRNOP00000004223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]