SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004351 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004351
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-27
Family PDZ domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 138-232
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-27
Family PDZ domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004351   Gene: ENSRNOG00000003232   Transcript: ENSRNOT00000004351
Sequence length 356
Comment pep:known chromosome:RGSC3.4:10:105237637:105254750:1 gene:ENSRNOG00000003232 transcript:ENSRNOT00000004351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLKKLGVPIREELLRAQEKSEHT
EPPAAADTKKAGDQNEAEKSHLERCELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVD
PDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIKAGGDEAKLLVVDKETDEFFKKCR
VTPSQEHLDGPLPEPFSNGEIQKENSREALVEPASESPRPALARSASSDTSEELNAQDSP
KRHDSTEPSSTSSSSDPILDFNISLAVAKERAHQKRSSKRAPQMDWSKKNELFSNL
Download sequence
Identical sequences Q9JJ19
ENSRNOP00000004351 ENSRNOP00000004351 NP_067605.1.100692 NP_067605.1.4139 10116.ENSRNOP00000004351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]