SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005076 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005076
Domain Number 1 Region: 128-257
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-44
Family Regulator of G-protein signaling, RGS 0.000000161
Further Details:      
 
Domain Number 2 Region: 62-118
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000249
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005076   Gene: ENSRNOG00000003800   Transcript: ENSRNOT00000005076
Sequence length 519
Comment pep:known chromosome:RGSC3.4:10:98598326:98647948:-1 gene:ENSRNOG00000003800 transcript:ENSRNOT00000005076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMQAKEQYRTGKERNKADRYALDCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKKQT
VTAVRKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFW
DLNAKLVEVPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYG
DQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKK
DSYARYLKSPIYKEMLAKAIEPQETTKRSSTLPFMRRHLRSSPSPVILRQLEEEERAREA
ANTVDITQPGQHLAPSPHLAVYTGTCVPPSPSSPFSPSCRSPRKPFPSPSRFIRRPSIAI
CPSPIRVALEGSSGLEGKGEASWSGANPGPPVTESIETSVDRSRPHSQPRAPLKARAALS
LGRFLRRGCLASPVFARLSPKCPSVSHGKVQPLGDMGQQLPRLKPKKVANFFQIKMEMPT
DSGPCLMDSDDPGAGESGDQTTEKEVICPWESLAEGKAG
Download sequence
Identical sequences ENSRNOP00000005076 10116.ENSRNOP00000005076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]