SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005251 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005251
Domain Number 1 Region: 25-155
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-49
Family Regulator of G-protein signaling, RGS 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005251   Gene: ENSRNOG00000003895   Transcript: ENSRNOT00000005251
Sequence length 162
Comment pep:known chromosome:RGSC3.4:13:58121191:58125514:-1 gene:ENSRNOG00000003895 transcript:ENSRNOT00000005251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMKAYLRSMIPHLESGMKSSKSKDILSAEEVMQWSQSLEKLLANQMGQNVFGKFLKSEF
SEENIEFWLACEDYKKTETDLLHNKAEHIYKAFVHSDAVKQINIDFHTRESTAKKIKTPT
PTCFDEAQKVIYALMEKDSYPRFLKSNIYLNLLNDLQANTLK
Download sequence
Identical sequences NP_062209.1.100692 NP_062209.1.4139 ENSRNOP00000005251 ENSRNOP00000005251 10116.ENSRNOP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]