SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005324 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005324
Domain Number 1 Region: 76-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-44
Family Regulator of G-protein signaling, RGS 0.000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005324   Gene: ENSRNOG00000003959   Transcript: ENSRNOT00000005324
Sequence length 235
Comment pep:known chromosome:RGSC3.4:13:58607898:58629597:-1 gene:ENSRNOG00000003959 transcript:ENSRNOT00000005324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMSLVFFSHLNMCESKEKTFFKLMHGSGKEETNIEAKIRAKEKRNRLSLLLQRPDFHGE
THTSRSALLAKETRVSSEEALKWAESFDKLLSHRDGVDAFTRFLKTEFSEENIEFWVACE
DFKKCTEPQQLILKAKSIYEKFIKNDAPKEVNLDFHTKEVITKSIAQPTLHSFDAAQSRV
CQLMEHDSYKRFLKSEIYLHLIEGRPQRPTNLRRRSRSFTYNEFQDVKSDVAIWL
Download sequence
Identical sequences G3V6I0
ENSRNOP00000005324 ENSRNOP00000005324 10116.ENSRNOP00000005324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]