SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005374 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005374
Domain Number 1 Region: 103-218
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005374   Gene: ENSRNOG00000003864   Transcript: ENSRNOT00000005374
Sequence length 333
Comment pep:known chromosome:RGSC3.4:19:26165665:26177257:-1 gene:ENSRNOG00000003864 transcript:ENSRNOT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGLGRRKKAPPLVENEEAEPSRSGLGVGEPGPLGGSGAGESQMGLPPPPASLRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIQLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSSGGHPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY
Download sequence
Identical sequences Q9Z254
NP_445793.1.100692 NP_445793.1.4139 XP_017456861.1.100692 ENSRNOP00000005374 10116.ENSRNOP00000005374 ENSRNOP00000005374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]