SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005498 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005498
Domain Number 1 Region: 140-247
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-24
Family PDZ domain 0.0000626
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000005498
Domain Number - Region: 319-426
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005498   Gene: ENSRNOG00000004052   Transcript: ENSRNOT00000005498
Sequence length 460
Comment pep:known chromosome:RGSC3.4:10:83680254:83688917:1 gene:ENSRNOG00000004052 transcript:ENSRNOT00000005498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEEPKAEAVPEEEASSSVATLERGVDNGRAPDMAPEEVDESKKEDFSEADLVDVSAYSGL
GEDSGGSALEEDDEEDEEDGEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFST
YSNEDYDRRNEDVDPMAASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGL
EKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIG
RERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGG
EMAIEVFELAENEDALSPVEMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGR
WRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRL
IKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKV
Download sequence
Identical sequences ENSRNOP00000005498 10116.ENSRNOP00000052415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]