SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005545 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005545
Domain Number 1 Region: 51-155
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-25
Family PDZ domain 0.029
Further Details:      
 
Domain Number 2 Region: 583-669
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-21
Family PDZ domain 0.0000184
Further Details:      
 
Domain Number 3 Region: 371-471
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-21
Family PDZ domain 0.00000658
Further Details:      
 
Domain Number 4 Region: 151-255
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 477-571
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.00000713
Further Details:      
 
Domain Number 6 Region: 905-1002
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-18
Family PDZ domain 0.00000755
Further Details:      
 
Domain Number 7 Region: 5-52
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000394
Family PDZ domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005545   Gene: ENSRNOG00000004013   Transcript: ENSRNOT00000005545
Sequence length 1041
Comment pep:known chromosome:RGSC3.4:7:59216565:59306131:1 gene:ENSRNOG00000004013 transcript:ENSRNOT00000005545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFCRSDQLDVGDYIKAVNGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSIQGSSV
MFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSV
DGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVA
LTTSVCCNKQVIVIDKIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTD
QVKLEILPHHQTRLALKGPDHVKIQRSDRQLPWDPWASSQCSVHTNHHHNPHHPDHCRVP
ALAFPKALTPNSPPAMVSSSSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKD
FKSSLSLASSTVGLAGQVVHTETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIE
ADSPAERCGVLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIP
SSGTFHVKLPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAID
NIRLDSCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITI
SGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETV
TLKIKKQTDAQPASSPKKLPIPSHSSDLGDGEEDPSPIQRPGKLSDVYPSTVPSVDSAVD
SWDGSGIDASYGSQGTTFQTSGYNFNTYDWRSPKQRASLSPVPKPRSQTYPDVGLSNEDW
DRSTASGFAGASDSADAEQEENFWSQALEDLETCGQSGILRELEEKADRRVSLRNMTLLA
TIMSGSTMSLNHEAPTARSQLGRQASFQERSNSRPHYSQTTRSNTLPSDVGRKSVTLRKM
KQEIKEIMSPTPVELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKP
YDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIEQPALPSDWSEQNS
AFFQQPSHGGNLETREPTNTL
Download sequence
Identical sequences 10116.ENSRNOP00000061369 ENSRNOP00000005545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]