SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005622 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005622
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 7.8e-19
Family Calbindin D9K 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005622   Gene: ENSRNOG00000004222   Transcript: ENSRNOT00000005622
Sequence length 79
Comment pep:known chromosome:RGSC3.4:X:52446817:52449347:1 gene:ENSRNOG00000004222 transcript:ENSRNOT00000005622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKKSPEEMKSIFQKYAAKEGDPNQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKN
GDGEVSYEEFEVFFKKLSQ
Download sequence
Identical sequences P02634
10116.ENSRNOP00000005622 ENSRNOP00000005622 NP_036653.1.100692 NP_036653.1.4139 ENSRNOP00000005622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]