SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005722 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005722
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-30
Family DEP domain 0.006
Further Details:      
 
Domain Number 2 Region: 181-263
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-16
Family PDZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005722   Gene: ENSRNOG00000004328   Transcript: ENSRNOT00000005722
Sequence length 267
Comment pep:known chromosome:RGSC3.4:7:91672567:91742576:1 gene:ENSRNOG00000004328 transcript:ENSRNOT00000005722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMSPETTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHSIIQHV
SNKHPFVDSNLLYQFRMNFRRRRRLMELLNEKSPSSQETHDSPFCLRKQSHDNRKSTSFM
SVSPSKEIKIVSAVRRSSMSSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTP
GAPYARKTFTIVGDAVGWGFVVRGSKPCHIQAVDPSGPAAAAGMKVCQFVVSVNGLNVLN
VDYRTVSNLILTGPRTIVMEVMEELEC
Download sequence
Identical sequences ENSRNOP00000005722 10116.ENSRNOP00000005722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]