SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005851 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005851
Domain Number 1 Region: 1-473
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.36e-154
Family Pyridoxal-dependent decarboxylase 0.000000000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005851   Gene: ENSRNOG00000004327   Transcript: ENSRNOT00000005851
Sequence length 480
Comment pep:known chromosome:RGSC3.4:14:92698636:92788635:-1 gene:ENSRNOG00000004327 transcript:ENSRNOT00000005851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRALIPTTAPQEPETYEDIIRDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKMIRQLQAASPELTQAALM
EKLVAYTSDQAHSSVERAGLIGGVKIKAIPSDGNYSMRAAALREALERDKAAGLIPFFVV
VTLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTEAFNMDPVYLRHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVKLSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNQLN
ETLLQRINSAKKIHLVPCRLRDKFVLRFAVCSRTVESAHVQLAWEHIRDLASSVLRAEKE
Download sequence
Identical sequences P14173
NP_001257781.1.100692 NP_001257781.1.4139 NP_036677.1.100692 NP_036677.1.4139 XP_006251537.1.100692 XP_008768474.1.100692 ENSRNOP00000005851 10116.ENSRNOP00000005851 ENSRNOP00000005851 ENSRNOP00000064520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]