SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005935 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005935
Domain Number 1 Region: 33-268
Classification Level Classification E-value
Superfamily Aquaporin-like 2.22e-35
Family Aquaporin-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005935   Gene: ENSRNOG00000004452   Transcript: ENSRNOT00000005935
Sequence length 290
Comment pep:known chromosome:RGSC3.4:9:92277514:92282986:1 gene:ENSRNOG00000004452 transcript:ENSRNOT00000005935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLNVSLSFFFATCAICEVARRASKALLPAGTYASFAREAVGAAQLAACCLEMRVLVEL
GPWAGGFGPDLLLTLVFLLFLVHGVTFDGASANPTVALQEFLMVEASLPSTLLKLLAQVL
GAQAACALTQRCWTWELSELHLLQSLMAVHCSSTLRTSVLQGTLVEGACTFLFHLSLLHL
QRSLLVYRAPALALLVTAMAYTAGPYTSAFFNPALAASVTFHCSGNTLLEYAHVYCLGPV
AGMILAVLLHQGHLPRFFERNLFYRQKSKYRTPRVKLSPGSVDTKMLKGE
Download sequence
Identical sequences D4A9T6
10116.ENSRNOP00000005935 ENSRNOP00000005935 NP_001102479.1.100692 NP_001102479.1.4139 ENSRNOP00000005935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]