SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005981 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005981
Domain Number 1 Region: 164-273
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.79e-28
Family Elongation factor TFIIS domain 2 0.0072
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 5.62e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000005981
Domain Number - Region: 295-352
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000272
Family Transcriptional factor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005981   Gene: ENSRNOG00000004531   Transcript: ENSRNOT00000005981
Sequence length 358
Comment pep:known chromosome:RGSC3.4:X:48642414:48643490:1 gene:ENSRNOG00000004531 transcript:ENSRNOT00000005981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKNQIIARASLIEQLVSKRYFEDIGKQLTELEMIYVSKEHLQETDVVRAVYRVLKNCP
SVTLKKKAKCLLAKWRGFYKNTHFKTRESLKVLHTDVNKEVSVAVSQDESQDETPGSSHN
EILGLCSSLSRLSPQDAAKAAAAFGSESSAAQMEINEGYLEDDSESPSKSSGVLDNPLVS
VRSKCIELLYKALASSCTDHTKVHFWQNLARQIEEHIFTLHSNDIKKYKNNIRSKVANLN
NPRNSHLQQNLLSGTISAREFAEMTVLDMANQELKQLRASYIESSIQEHHLPQIVDGTHT
NKIKCRRCDKYNCTVTVIARGTLFLPSWVQNSNPDEQMTYVICNECGEQWYHNDWVCL
Download sequence
Identical sequences D4AEK4
10116.ENSRNOP00000005981 ENSRNOP00000005981 NP_001102485.1.100692 NP_001102485.1.4139 XP_006256918.1.100692 XP_008771404.1.100692 ENSRNOP00000005981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]