SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006083 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006083
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 9.33e-30
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 10-66
Classification Level Classification E-value
Superfamily L27 domain 5.1e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006083   Gene: ENSRNOG00000004527   Transcript: ENSRNOT00000006083
Sequence length 218
Comment pep:known chromosome:RGSC3.4:7:45970622:46116986:1 gene:ENSRNOG00000004527 transcript:ENSRNOT00000006083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMH
ETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIY
ISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVL
EEMEARFEKLRTARRRQQQQLLIQQQQQQQQPQQNHMS
Download sequence
Identical sequences F1LQV9
ENSRNOP00000006083 ENSRNOP00000006083 10116.ENSRNOP00000006083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]