SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006387 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006387
Domain Number 1 Region: 69-165
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-19
Family PDZ domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006387   Gene: ENSRNOG00000004772   Transcript: ENSRNOT00000006387
Sequence length 359
Comment pep:known chromosome:RGSC3.4:3:39893893:39921114:-1 gene:ENSRNOG00000004772 transcript:ENSRNOT00000006387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQRLLQQQSSNGNLEYCADSAYSSYPTLTGPLTVEDNRRIQMLADTVATLPRGRKQLA
LARSSSLGDFSCSQRKVVTVEKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKVQEDSPA
HCAGLQVGDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMIHRRAELEAKLQT
LKQTLKKKWVELRSLHLQEQRLLHGDAANSPNLENMNLDESSLFGNLLGPSPAFLDRPRL
SSESSCKSWLSSLTVDSEDDYGTSVSEDSIRGAFSRQTSTDDECFHSKDGDEILRNASSR
RNRSISITSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHRAVEEEESRF
Download sequence
Identical sequences Q5I0L6
ENSRNOP00000006387 10116.ENSRNOP00000006387 ENSRNOP00000006387 NP_001012086.1.100692 NP_001012086.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]