SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006423 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006423
Domain Number 1 Region: 187-299
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-37
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 2 Region: 104-202
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-24
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 3 Region: 322-433
Classification Level Classification E-value
Superfamily PH domain-like 0.00000238
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006423   Gene: ENSRNOG00000004821   Transcript: ENSRNOT00000006423
Sequence length 539
Comment pep:known chromosome:RGSC3.4:7:92156715:92426444:-1 gene:ENSRNOG00000004821 transcript:ENSRNOT00000006423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAAAAAVAAPAGGGGARAQRSGLLEVLVRDRWHKVLVNLSEDALVLSCEEGATAYNG
IGTTTNGSFCRGSGTGHPGTGVPQAPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQE
LGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQA
LKRAGKEVLLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGSGSADPLSSQPFSFHR
DRKSIPLKMCYVTRSMTLADPENRQLEIHSPDAKHTVVLRSKDSATAQAWFSAIHSNVGD
LLVRVVADIREQLGKTGIAGSREIRHLGWLAEKVPGESEKQWKPALVVLTEKDLLIYDSM
PRRKEAWLSPVHSYPLLATRLVHSGPGKGSPQAAMDLSFATRTGTKQGIETHLFRAEISR
DLSHWTRSIVQGCHNSAELTAEITTACTYRNQECRLTIHYDNGFSISTEPQDGAFPKTII
QSPYEKLKMSSDDGIRMLYLDFGGKEGEIQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
Download sequence
Identical sequences D3ZWC6
10116.ENSRNOP00000006423 NP_001124014.1.100692 NP_001124014.1.4139 XP_017450243.1.100692 ENSRNOP00000006423 ENSRNOP00000006423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]