SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006429 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006429
Domain Number 1 Region: 54-200
Classification Level Classification E-value
Superfamily UBC-like 1.55e-59
Family UBC-related 0.000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006429   Gene: ENSRNOG00000004544   Transcript: ENSRNOT00000006429
Sequence length 201
Comment pep:known chromosome:RGSC3.4:3:61554636:61610913:1 gene:ENSRNOG00000004544 transcript:ENSRNOT00000006429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRALAPAVVVQMQTSETLPLQSLRNRKKENLLPPSRRKTPNSLAKRLLSYPLVLKANRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YLTNRAEHDRIARQWTKRYAT
Download sequence
Identical sequences F7F5A1
10116.ENSRNOP00000006429 ENSRNOP00000006429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]