SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006747 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006747
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily UBC-like 1.57e-51
Family UBC-related 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006747   Gene: ENSRNOG00000005038   Transcript: ENSRNOT00000006747
Sequence length 204
Comment pep:known chromosome:RGSC3.4:13:47924340:47934842:1 gene:ENSRNOG00000005038 transcript:ENSRNOT00000006747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRASRLKKELHMLAIEPPPGVTCWQEKDKMDNLRAQILGGANTPYEKGIFTLEVIVPER
YPFEPPQIRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNP
DDPLMADISSEFKYNKIAFVKKARQWTETHARQKQKAGEEEVGISSEVGDSEESHSTQKR
KARPLGGMQKRFSPDVQRVCPGPS
Download sequence
Identical sequences G3V6M7
10116.ENSRNOP00000006747 NP_001101814.2.100692 NP_001101814.2.4139 ENSRNOP00000006747 ENSRNOP00000006747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]