SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006787 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006787
Domain Number 1 Region: 119-178
Classification Level Classification E-value
Superfamily BPTI-like 6.81e-22
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 
Domain Number 2 Region: 49-106
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0017
Further Details:      
 
Domain Number 3 Region: 219-273
Classification Level Classification E-value
Superfamily BPTI-like 1.32e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006787   Gene: ENSRNOG00000005039   Transcript: ENSRNOT00000006787
Sequence length 302
Comment pep:known chromosome:RGSC3.4:3:67654389:67697178:-1 gene:ENSRNOG00000005039 transcript:ENSRNOT00000006787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNKLKKDHAFWAAVCLLLSIVPELLNALPEEDDDTINTDSELRPMKPLHTFCAMKAEDG
PCKAMIRSYYFNMNSHQCEEFIYGGCRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEK
PDFCFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCEDPVNE
VQKGDYVTNQITVTDRTTVNNVVIPQATKAPSQWDYDGPSWCLEPADSGLCKASEKRFYY
NPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSKKSSKRAKTQRRRKSFVKVMYEN
IH
Download sequence
Identical sequences Q02445
ENSRNOP00000006787 NP_058896.1.100692 NP_058896.1.4139 XP_006234502.1.100692 XP_006234503.1.100692 XP_006234506.1.100692 ENSRNOP00000006787 10116.ENSRNOP00000006787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]