SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006830 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006830
Domain Number 1 Region: 3495-3684
Classification Level Classification E-value
Superfamily UBC-like 1.75e-39
Family UBC-related 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006830
Domain Number - Region: 2146-2235
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0706
Family Galactose-binding domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006830   Gene: ENSRNOG00000027191   Transcript: ENSRNOT00000006830
Sequence length 3794
Comment pep:known chromosome:RGSC3.4:6:20655188:20767088:-1 gene:ENSRNOG00000027191 transcript:ENSRNOT00000006830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDSNSWDEHVFELVLPKACMVGHVDFKFVLNSTITSVPQIQVSLLRNRAPGLGKANALNI
EVEQNGNPSLVDLNEEMHPMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAGM
LTLTSPKLVKGMAGGKYRSFLIHIKAVSDRGADEVCSSGLRPVVRLPSLKQQGHKGYSLA
SLLAKVAAGKEKSSNVKNESAGGTRKSENLRGCDLLQEVSVTIRRFKKTSICKERVQRCA
MLQFSEFHEKLLNTLCRRSDDGLVTEHAQSLVLDTLCWLAGVHSNGPGSSKEGNECLLSK
TRTCLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPYQPGFGSVLLKALLDNMCFLP
AAATGGSVYWYFVLLNYVKDEDLAACSTACAALLTAVSRQLQDRLTPLEALLQTRYGLYS
SPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTGL
LEVEPLHFTCVSTSDGTRIERDDASTFTVSSFGVTPAVGGLSSGTVGEASTALSSAAQVA
LQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAAAAAGPVH
NAVPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVI
DPPAVNLAAHNKNANKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTL
DFGRPILLTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVC
RFMKITVIGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLRGEGESANQPEIDQH
LAMMVALQEDIQCRYNLACHRLEALLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSA
YQDCIQLQLQLNLAHNAVQRLKVAIGASRKTLSETSGPEDLIPTSSTEQLRTIVRYLLDT
LLSLLHSSNGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWG
QFLSNVLQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPEL
TMHRRTEGVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGKDRERFLTGNQWSFI
NNNLHTQSLNRSSKGGSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSN
KGSSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTLA
HDRCISVVQKLVLFLLSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLL
LLLVGTDFNRGDISWGGAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVSDDVGATAGD
SDDSLQQSSVQLLETIDEPLTHEIAGTPPLSSLEKDKEIDLELLQDLMEADIDPLDIDLE
KDPLAAKVFKPISSTWYDYWGADYGTYNYNPYIGGLGMPVAKPPSNTEKNGSQTVSVSVS
QALDARLEVGLEQQAELMLKMMSTLEADSILQALTSTPPTFSQSPSGTDDSLLGSLQPAN
QNSQLIIQLSSVPMLNVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSSGNKENGADIF
LYNANRIPVISLNQASITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSSIGA
QETTAHLLVSDPNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTC
PQIFSELLLKLIHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVT
FLVHHYITCSDKVMSRSGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLK
LVNILVQLPLSSNREYSARVSMTTNTTDSVSDEEKVSGGKDVNGSNTSIPGSPAYVADLV
LANQQIMSQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLS
KKASTVHMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGV
QLICNNMVTSTRAIVNTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFA
PLGTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPSAVLLKEIH
IQPHLASLATCPSSVSVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHR
PRDASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDL
EGMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNC
AASGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSAKMA
ALKRSGRMNYMCPSSSAVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDRELFEL
LFNWSMSLPCNVVLKKAVDSLLCSMCHIHPNYFSLLMGWMGIIPPPVQCHHRLSMTDDSK
KQDLSSSLTDDSKNAQAPLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCF
SHISYSESIAQSIDNSQDKLRRHHVPQHCNKMPITADLVAPILRFLTEVGNSHIMKDWLG
GSEVNPLWTALLFLLCHSGSTAGGHNLGAQQSSTRSASHSSAATTVLTTQQRTAIENATV
AFFLQCISCHPNNQKLMAQVLCELFQTAPQRGSLPTSGNISGFVRRLFLQLMLEDEKVTM
FLQSPCPLYKGRINATSHVIQHPMFGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLI
SEQKDDKEKKNHEEKEKVKADNGFQDNYSVVVASGLKSQSKRAVSSTPPRPPSRRGRAIP
DKIGSTSSSADTANKIITVPVFHLFHRLLAVSHVPAEMTLAQLLSLLYDGKRQGYRSIDL
TVKLGSKVITDPSLSKTDSFKRLHPEKDHGELIGSCPEDEALTPSDECMDGVLDESLLET
CPIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVVASTTQEKPKDSDQFEWVTIEQ
SGELVYEAPETIAAEPPPVKSAVQATSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCL
LRLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSATPLTTDDGVLLRRMALEIGAL
HLILVCLSALSHHAPRVPNSSLNQTEPQVSNSHNPTSTEEQQLYWAKGTGFGTGSTASGW
DVEQALTKQRLEEEHVTCLLQVLASYINPMSSAVNGEAQVSPESRAQNSSALPSVLLELL
SQSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCTSMVPLLLPLSTENGEEEE
EEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENIKTGVKPDAPDQEPEGLTLLVPDIQR
TAEIVHAATTNLRQANQEKKLGEYSKKVAMKPKPLSVLKSLEEKYVAVMKTLQFDTFEMV
SEDDDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDE
ERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDG
KVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQS
SREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEVMAQCEEWIADIQQYSSD
KRVGRTMSHHAAALKRHTAQLREELLKLPCPQGLDPDIEDASPVCRATAGAEETLTHDHV
KPSSSKDIPSDFQL
Download sequence
Identical sequences 10116.ENSRNOP00000058972 ENSRNOP00000006830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]