SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006848 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006848
Domain Number 1 Region: 35-56,84-618,654-666
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 6.41e-148
Family Prokaryotic type I DNA topoisomerase 0.0000138
Further Details:      
 
Domain Number 2 Region: 643-686
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000116
Family PhnA zinc-binding domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000006848
Domain Number - Region: 974-999
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0146
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006848   Gene: ENSRNOG00000005099   Transcript: ENSRNOT00000006848
Sequence length 1001
Comment pep:known chromosome:RGSC3.4:10:46886329:46923435:-1 gene:ENSRNOG00000005099 transcript:ENSRNOT00000006848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFPVTLLAFQWQRRPGGRALSRAAMEVAFRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
KEGLSKFNKIYEFDYHLYGQNVTMIMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFIDIKKTLERETQHCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITHHAVRAACEHLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEVFHRIKVTHDHKDGTVEFNWKRYRLFNHTACLVLY
QLCMEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYM
QTDGTQMYIFTKQIALTALPEVLSSIPHKGGFCSDILERAAPSQMGKSDQAHPPIHPTKY
TSSLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLIILARNYLDVYP
YDHWSDKLLPVYEQGFRFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHI
ETIKARMYVGLTSDKRFLPGHLGMGLVEGYDSMGYEMSKPNLRAELEADLKLICEGKKDK
FQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYLGERTEVAQQEEIYPAMPEPVRKCPQCN
KDMVLKTKKSGGFYLSCTGFPECRSAVWFPDSVLEASRDSSVCSVCQPAPVYRLKLKFKR
GSLPPSMPLEFVGCIGGCDETLKEIFGLRFSRAPPRASQPSGHLQASQALNRMDSSQRSL
SQPLVNRHTGPSKAVAQTLLPPTAAAEGNSVTCNCGREAVLLTVRKQGPNQGRHFYKCSG
GDCNFFLWADSSHPTGGGPPTSVSRPPGNSVGCPSGFGSHMDGFGSLGGDGDGGASCLCG
QPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENMAPGSFAAPAWPGGRGKAQRP
EAASKRQRAGSLDAGSTVKKPRKCSLCHQPGHTRPFCPQNR
Download sequence
Identical sequences ENSRNOP00000006848 10116.ENSRNOP00000006848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]