SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008306 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008306
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 1.14e-70
Family Integrin A (or I) domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 1130-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 5.59e-36
Family Fibronectin type III 0.00000337
Further Details:      
 
Domain Number 3 Region: 1522-1723
Classification Level Classification E-value
Superfamily Fibronectin type III 5.78e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 992-1110
Classification Level Classification E-value
Superfamily CalX-like 3.53e-20
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 5 Region: 626-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.66e-18
Family Integrin beta tail domain 0.0021
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000277
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000008306
Domain Number - Region: 580-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0809
Family Integrin beta EGF-like domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008306   Gene: ENSRNOG00000005580   Transcript: ENSRNOT00000008306
Sequence length 1819
Comment pep:known chromosome:RGSC3.4:10:106080448:106116634:1 gene:ENSRNOG00000005580 transcript:ENSRNOT00000008306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLCSSPWVKLLLAVVLSAGLPGNMANRCKKAQVKSCTECIRVDKSCAYCTDELFKERR
CNTQAELLAAGCRGESVLVMESSLEITENIQIDTSLHRSQVSPQGLQVRLRPGEERNFVF
KVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWDKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYK
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLE
EAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDG
THVCQMAKEDQRGNIHLKPSFSDGLRMDASVICDVCACELQKEVQSARCHYRGDFMCGHC
VCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYD
NFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECG
RCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMV
DELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCPPGSFWWLIPLL
IFLLLLLVLLLLLCWKYCACCKACLGLLPCCNQGHMVGFKEDHYMLRENLMASDHLDTPM
LRSGNLKGRDTVRWKITNNVQRPGFATHAASISPTELVPYGLSLRLGRLCTENLMKPGTR
ECDQLRQEVEENLNEVYRQVNGVHKLQQTKFRQQPNAGKKQDHTIVDTVLLAPRSAKQSL
LKLTEKQVEQGSFHELKVAPGYYTLTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEK
QLLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYSVSRGDQVARIPVIRHILD
NGKSQVSYSTQDNTAHGHRDYVPVEGELLFYPGETWKELQVKLLELQEVDSLLRGRQVRR
FQVQLSNPKFGARLGQPNTATVIIGEQDETDRSLINEISASPPLPRGDLGAPQNPNAKAA
GSRKIHFNWLPPPGKPMGYRVKYWVQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCA
YGAHGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYG
LVNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLAT
QPKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTGGGWKFEPL
LGEELDLRRVTWRLPPELIPRLSASSGRSDEDSSVTGGVEGEGGGWIRGATPRPPGEHLV
NGRMDFAYPGSANSLHRMTAANVAYGTHLSPHQTHRMLSTSSTLTRDYHSLTRTDHSQSG
TLPRDYSTLTSLSSQDSRGAMGVPDTPTRLVFSALGPTSLKVSWQEPQCDRALLGYSVEY
QLLNGGEMHRLNIPNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHP
QSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGG
GPARTFRVDGDNPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQ
LGSHSGLFQNPLQSEYSTVTSTHSTTTTEPFLIDGLTLGTQRLEAGGSLTRHVTQEFVSR
TLTTSGSLSTHMDQQFFQT
Download sequence
Identical sequences 10116.ENSRNOP00000048660 ENSRNOP00000008306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]