SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008407 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008407
Domain Number 1 Region: 12-144
Classification Level Classification E-value
Superfamily MAPEG domain-like 2.88e-35
Family MAPEG domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008407   Gene: ENSRNOG00000006320   Transcript: ENSRNOT00000008407
Sequence length 156
Comment pep:known chromosome:RGSC3.4:3:9946935:9957540:-1 gene:ENSRNOG00000006320 transcript:ENSRNOT00000008407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLGLVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYC
RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG
KMNPRIRSGAYVLAQFACFSMALQILWEGPPSVTSS
Download sequence
Identical sequences 10116.ENSRNOP00000008407 ENSRNOP00000008407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]