SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009222 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009222
Domain Number 1 Region: 589-655,792-1019
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.75e-64
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 
Domain Number 2 Region: 1060-1388
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.97e-40
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0046
Further Details:      
 
Domain Number 3 Region: 16-144
Classification Level Classification E-value
Superfamily UBC-like 5.36e-37
Family RWD domain 0.0000005
Further Details:      
 
Domain Number 4 Region: 336-549
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.49e-35
Family Protein kinases, catalytic subunit 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000009222
Domain Number - Region: 1400-1492
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00523
Family Anticodon-binding domain of Class II aaRS 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009222   Gene: ENSRNOG00000006027   Transcript: ENSRNOT00000009222
Sequence length 1649
Comment pep:known chromosome:RGSC3.4:3:104820334:104906286:1 gene:ENSRNOG00000006027 transcript:ENSRNOT00000009222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRGAAGRGPAEPQESYSQRQDHELQALEAIYGSDFQDLRPDARGRVREPPEINLVLY
PQGLAGEEVYVQVELRVKCPPTYPDVVPEIELKNTKGLSNESVNLLKSHLEELAKKQCGE
VMIFELAHHVQSFLSEHNKPPPKSFHEEMLERQAQEKQQRLLEARQKEEQEQREILHEIQ
KRKEEIKEEKKRKEMAKQERLEITSLTNQDHASKRDPAGHRAAAILHGGSPDFVGNGKAR
AHSSGRSRRERQYSVCSGEASPGSCDILYFCVGSADQLMVHKGKCVGDDEQLGKVVYNAL
ETATGSFVLLYEWVLQWQKKMGPCLTSQEKEKIDKCKKQIQGAETEFSSLVKLSHPNIVR
YFAMNSREEKDSIVVDILAEHISGISLAAHLSHSGPVPMHQLRKYTAQLLAGLDYLHRNS
VVHKVLSTASVLVDAEGTVKITDYSISKRLADICKEDVFEQTRVRFSDSALPYKTGKKGD
VWRLGLLLLSLSQGQECEEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSGGQDYIETIIPSNQLPSAAFFTETQRQFSRYFIEFEELQLLGKGA
FGAVIKVQNKLDGCCYAVKRIPINPASRQFRRIKGEVTLLSRLHHENIVRYYNAWIERHE
RPAVPGTPPPDYIPQAQNSSATGGKASGDTEELGSVEAAAPPPILSSSVEWSTSAERSNS
ARFPVTGQDSSSDEEDEDERDGVFSQSFLPASDSDSDIIFDNEDENSKSQNQDEDCNEKD
SRHEIEPSVTTEAVHYLYIQMEYCEKSTLRDTIDQGLFRDTSRLWRLFREILDGLAYIHE
KGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFNAEGKQDDQAGDHVIKSDPSGHLTG
MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIILFEMSYHPMVTASERIFVLNQLRDPTSP
KFPDDFEDGEHTKQKSVISWLLNHDPAKRPTAMELLKSELLPPPQMEESELHEVLHHTLA
NTDGKAYRTMMSQLFCQHSSPAIDYTYDSDILKGNFLIRTAKIQQLVCETIVRVFKRHGA
VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRVPFARYVARNNILNLKRYCIE
RVFRPRKLDRFHPKELLECAFDIVTSTANSSLPTAETIYTIYEVIQEFPALQERNYSIYL
NHTMLLKAILLHCGIPEDKLSQVYVILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLTPTINSLIKQKTGIAQLVKYSLKDLEEVVGLLKKLGVKLQVSINLGLVYK
VQQHNGIIFQFLAFSKRRQRVVPEILAAGGRYDLLIPKFRGPQALGPVPTAVGVSIAIDK
IFAAVLNMGEPVTVSSCDLLVVSAGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ
EYCRHHEITYVALVSDKEGSHVKVKSFEKERQTEKRVLESDLVDHVMQKLRTKVGDERNF
RDASDNLAVQTLKGSFSNASGLFEIHGTTVVPTVSVISPEKLSASTRRRHEIQVQTRLQT
TLANLHQKSSEIEILAVDLPKETILQFLSLEWDADEQAFNTTVKQLLSRLPKQRYLKLVC
DEIYNIKVEKKVSVLFLYSYRDDYYRILF
Download sequence
Identical sequences ENSRNOP00000009222 10116.ENSRNOP00000009222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]