SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000009248 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000009248
Domain Number 1 Region: 26-189
Classification Level Classification E-value
Superfamily Lipocalins 3.82e-38
Family Retinol binding protein-like 0.00081
Further Details:      
 
Domain Number 2 Region: 224-282
Classification Level Classification E-value
Superfamily BPTI-like 6.39e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00027
Further Details:      
 
Domain Number 3 Region: 285-337
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000009248   Gene: ENSRNOG00000006889   Transcript: ENSRNOT00000009248
Sequence length 349
Comment pep:known chromosome:RGSC3.4:5:80119727:80129955:-1 gene:ENSRNOG00000006889 transcript:ENSRNOT00000009248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGLGALFLLLTACLTLKADNVPTLPDIQVQENFNEARIYGKWFNLAVGSTCPWLRRIKN
KMSVSTLVLQEGATEAEISVTSTQWRKGVCEEISGVYQKTDIDGKFLYHKSKWNATLESY
VVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEFREVALSVGIPENSIVF
MADRGECVPGDREVESTSFARARRAVLPQENEGSGSEPLITGTLKKEDSCQLNYSEGPCL
GMQQKYYYNGASMACETFQYGGCLGNGNNFASEKECLQTCRTIAACNLPIVQGPCRAFAE
LWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS
Download sequence
Identical sequences Q64240
NP_037033.1.100692 NP_037033.1.4139 ENSRNOP00000009248 10116.ENSRNOP00000009248 ENSRNOP00000009248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]